PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 17886
Common NamebZIP, SELMODRAFT_17886
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family bZIP
Protein Properties Length: 96aa    MW: 11242.6 Da    PI: 11.6524
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
17886genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.39.3e-151368358
            XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
  bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58
            ++k+++r+ +NRe+ArrsR+RK++ +eeL+     L a+N+    +l+  +++ ++
   17886 13 DDKKQKRMLSNRESARRSRLRKQQHMEELRSQLLDLRAQNSHILGKLSVASQQFSQ 68
            68**************************************9877766666665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-141175IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4841376IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.3E-111368No hitNo description
PfamPF001702.6E-111465IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.56E-121566No hitNo description
CDDcd147023.82E-121667No hitNo description
PROSITE patternPS0003601833IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
STSEEDQQLR GVDDKKQKRM LSNRESARRS RLRKQQHMEE LRSQLLDLRA QNSHILGKLS  60
VASQQFSQIS HDNQLLRLQA SELGRQLQRL HRQASV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12733RRSRLRK
22734RRSRLRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00267DAPTransfer from AT2G18160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002981958.11e-59hypothetical protein SELMODRAFT_17886, partial
TrEMBLD8SEW82e-59D8SEW8_SELML; Putative uncharacterized protein bZIP (Fragment)
STRINGEFJ170515e-59(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5511678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.11e-19basic leucine-zipper 2
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]